PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_07475-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bHLH
Protein Properties Length: 178aa    MW: 18867.3 Da    PI: 5.3038
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_07475-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH33.48.4e-1188118131
                      CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC. CS
              HLH   1 rrrahnerErrRRdriNsafeeLrellPkas 31 
                      +r++h ++Er+RR+++N+ ++ Lr+l+P+++
  TRIUR3_07475-P1  88 QRMTHIAVERNRRRQMNEYLAVLRSLMPESY 118
                      79**************************974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474593.93E-1079131IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000835.65E-986121No hitNo description
Gene3DG3DSA:4.10.280.101.7E-986120IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088811.36987158IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.5E-888118IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MTLDALCAAG DVLVYDTFNA AAAVSAAPAE SSLLFCDVAG AAWMAGSAAA EAPAVTIVPV  60
EEGEKAQGRR KRRRRARSCK NREDAESQRM THIAVERNRR RQMNEYLAVL RSLMPESYAH  120
RVEEGCGLTT ADDIAAAEGC GLTPADAIAA AVHHVLCLVD AEATSQRLLA GGQQEILS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16874RRKRRRR
26973RKRRR
36976RKRRRRAR
48899RMTHIAVERNRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6629814e-72AL662981.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0086O06, complete sequence.
GenBankAP0149604e-72AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126124e-72CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankCR8552354e-72CR855235.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0142I02-OSIGBa0101B20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006647713.13e-25PREDICTED: transcription factor bHLH96
TrEMBLM7YPX61e-126M7YPX6_TRIUA; Transcription factor bHLH94
STRINGMLOC_45114.11e-44(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104622843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22490.11e-20bHLH family protein